A Specificity Map for the PDZ Domain Family

This data is supplementary material for:

A Specificity Map for the PDZ Domain Family

Raffi Tonikian1,2,9, Yingnan Zhang3,9, Stephen L. Sazinsky4, Bridget Currell5, Jung-Hua Yeh6, Boris Reva7, Heike A. Held3, Brent A. Appleton3, Marie Evangelista5, Yan Wu8, Xiaofeng Xin1,2, Andrew C. Chan6, Somasekar Seshagiri5, Laurence A. Lasky3, Chris Sander7, Charles Boone1,2, Gary D. Bader1,2,7+, Sachdev S. Sidhu3+

1 Terrence Donnelly Center for Cellular and Biomolecular Research, Banting and Best Department of Medical Research, University of Toronto, Toronto, Ontario, Canada,

2 Department of Molecular Genetics, University of Toronto, Toronto, Ontario, Canada

3 Department of Protein Engineering, Genentech, South San Francisco, California, United States of America

4 Department of Biological Engineering, Massachusetts Institute of Technology, Cambridge, Massachusetts, United States of America

5 Department of Molecular Biology, Genentech, South San Francisco, California, United States of America

6 Department of Immunology, Genentech South San Francisco, California, United States of America

7 Computational Biology Center, Memorial Sloan-Kettering Cancer Center, New York, New York, United States of America

8 Department of Antibody Engineering, Genentech, South San Francisco, California, United States of America

9 These authors contributed equally to this work

+ Current Address: Terrence Donnelly Center for Cellular and Biomolecular Research and Banting and Best Department of Medical Research, University of Toronto, Toronto, Ontario, Canada

PDZ Data

This data has been submitted to the [http://mint.bio.uniroma2.it/domino DOMINO (MINT)] and [http://icb.med.cornell.edu/services/pdz/start PDZBase] databases.

File Format

Each zip file contains a set of peptide files as shown in the example below. A peptide file describes a protein containing a specific domain, and provides known peptide ligands of this domain obtained by an experimental technique. These files can be directly loaded into the [http://www.baderlab.org/Software/LOLA LOLA software], which can be used to visualize peptide sets as sequence logos and to create Logo Trees, or the [http://baderlab.org/Software/BRAIN BRAIN software], which is a Cytoscape plugin that can be used to search protein sequence databases for proteins that contain sequence patterns matching a set of peptides.

The peptide file consists of a Header Section that describes the protein and domain sequence, and a Peptide Section that lists and describes the peptide ligands.

Example:

Gene Name       DLG1
Accession       Refseq:NP_004078
Organism        Homo Sapiens (Human)
NCBITaxonomyID  9606
Domain Number   3
Domain Type     PDZ
Interpro ID     IPR001478
Technique       Phage Display High Valency
Domain sequence KVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVA
Domain Range    466-525
Comment
PeptideName     Peptide CloneFrequency  QuantData       ExternalIdentifier
1       XLHFWRESSV      66
2       XXRLWKQTSL      3
3       ILKIWRETSL      3
4       KRTIWRETSL      2
A       KNLRSNSMLG      2
6       HLKFWRSTRV      2
7       AHSKWRSTSV      2
8       XXXHRRETTV      1
9       VISRWRQTSL      1
10      TTWLGRQTRV      1
11      SRSSYRETSV      1
12      XXXSRRETSV      1
13      RLFRYRETSL      1
B       PIRKRWTMTL      1
15      XXXNHRETSV      1
16      KIVRWKNTSV      1
17      KHRTWYETSV      1
18      XXXXFKQTSV      1
19      ARPKWRTTRV      1
20      ALPRRRETSV      1

Header Section

Describes the protein, domain, and experiment. Required fields are indicated with a *.

NOTE: This section is in a 2 column format. Field names must be separated from their values with a single TAB character. Multiple TABs, or spaces, are not accepted.

Peptide Section

Describes the experimentally determined peptide ligands. The peptide sequences must be in multiple alignment format. The sequences should contain no gaps, and should be padded with the X symbol on both sides, where required, such that all sequences have identical length.

NOTE: This section is in a 5-column format. Column headers and values must be separated with a single TAB character. Multiple TABs or spaces are not accepted.

Required fields are indicated with a *.

Supplementary Tables

Data/PDZ (last edited 2008-09-11 03:06:00 by GaryBader)

MoinMoin Appliance - Powered by TurnKey Linux