SH3 Interactome Conserves General Function Over Specific Form

This data is supplementary material for:

SH3 Interactome Conserves General Function Over Specific Form

Data

Protein-protein interaction data has been submitted to the IntAct database.

File Format

Each zip file contains a set of peptide files as shown in the example below. A peptide file describes a protein containing a specific domain, and provides known peptide ligands of this domain obtained by an experimental technique. These files can be directly loaded into the LOLA software, which can be used to visualize peptide sets as sequence logos and to create Logo Trees, or the BRAIN software, which is a Cytoscape plugin that can be used to search protein sequence databases for proteins that contain sequence patterns matching a set of peptides.

The peptide file consists of a Header Section that describes the protein and domain sequence, and a Peptide Section that lists and describes the peptide ligands.

The peptides have been aligned with MUSCLE (Nucl. Acids Res. (2004) 32 (5): 1792-1797) and all multiple alignments have been manually curated. For some domains (STAM-1 = C34G6.7 and HUM-1 = F29D10.4), the interacting peptides have bee split into two groups corresponding to Class I (RxxPxxP) and class II (PxxPxR) SH3 ligands.

Example:

Gene Name       B0303.7
Accession       Refseq:B0303.7
Organism        C. elegans
NCBITaxonomy    ID9606
Domain Number   1
Domain Type     SH3
Interpro ID     IPR001452
Technique       Phage Display High Valency
Domain sequence PSYSAPAISTPYGIAKFDYAPTQSDEMGLRIGDTVLISKKVDAEWFYGENQNQRTFGIVPSSYLDIKIPLKEAFTAL
PeptideName     Peptide CloneFrequency
1       GSEVPPVPPRPV    1
2       SLDPPPVPPRPV    1
3       ASARPPVPPRPL    1
4       SNLDHWQPGEPV    1
5       DMRAPPVPPRPD    1
6       XXXAPLPPPRPD    1
7       FQDVRIAPQVPA    1
8       APVAPEPPPRPH    1
9       SXIVPTVPPVPD    1
10      GQTAPPVPARPA    1
11      EGVAPPPPPRPV    1
12      FTTAPPVPPRPL    1
13      LGTAPPVPARPI    1
14      SEILPTIPPRPD    1
15      SGTPPPVPTRPD    1
16      VTEAPQVPPRPF    1
17      GETAPPVPPRPL    1
18      LPEPPPPPPRPV    1
19      LLDTPAVPTRPC    1
20      YGAAPPVPPRPV    1
21      QPKAPPVPVRPS    1
22      LLDTPAVPTRPC    1
23      GEYAPPVPPRPD    1
24      DITAPPPPPRPY    1
25      VRETPPVPARPA    1
26      SLDPPPVPPRPV    1
27      LDRVPPPPARPS    1
28      XGEAPPAPPRPG    1
29      VDAAPPVPQRPA    1
30      GATAPPVPPRPN    1
31      GDLPPPVPPRPS    1

Header Section

Describes the protein, domain, and experiment. Required fields are indicated with a *.

NOTE: This section is in a 2 column format. Field names must be separated from their values with a single TAB character. Multiple TABs, or spaces, are not accepted.

Peptide Section

Describes the experimentally determined peptide ligands. The peptide sequences must be in multiple alignment format. The sequences should contain no gaps, and should be padded with the X symbol on both sides, where required, such that all sequences have identical length.

NOTE: This section is in a 5-column format. Column headers and values must be separated with a single TAB character. Multiple TABs or spaces are not accepted.

Required fields are indicated with a *.

Data/SH3Worm (last edited 2013-02-11 13:38:39 by GaryBader)

MoinMoin Appliance - Powered by TurnKey Linux