Size: 4498
Comment:
|
Size: 4486
Comment:
|
Deletions are marked like this. | Additions are marked like this. |
Line 1: | Line 1: |
#acl All:read | |
Line 3: | Line 4: |
LOLA is currently in beta-testing. Version 1.0-beta is now available for download. | LOLA is currently in beta-testing. Version 1.2-beta is now available for download. |
Line 7: | Line 8: |
=== Latest Download === | ---- == Downloads == === Latest Release === ''LOLA Version 1.3 Beta (September 29, 2008)''[[BR]] Build: attachment:LOLA-1.3-beta.tgz [[BR]] Source: To be posted by October 2, 2008 |
Line 9: | Line 15: |
LOLA Version 1.0 Beta: [attachment:lola-1.0-beta.tar Download] | === Earlier Releases === ''LOLA Version 1.2 Beta (May 12, 2008)''[[BR]] Build: attachment:LOLA-1.2-beta.tgz [[BR]] Source: attachment:LOLA-1.2-beta-src.tgz |
Line 11: | Line 20: |
=== Requirements === | ''LOLA Version 1.1 Beta (August 22, 2007)''[[BR]] Build: attachment:LOLA-1.1-beta.tgz [[BR]] Source: attachment:LOLA-1.1-beta-src.tgz === Release Notes === '''Version 1.3 beta:''' * Progress bars now appear for long-running tasks such as loading peptide file and generating logos and logo trees * Notable bug fixes: * Selected profiles now correctly closed with the "Close Selected" button. * Regenerating a logo tree after closing some profiles now correctly excludes the closed profiles. |
Line 13: | Line 31: |
Java Runtime Environment (JRE) 1.5 or later is required to run LOLA. All other dependencies are included in the download. | '''Version 1.2 beta:''' * Logo trees can be generated for all types of domains - not only terminal binding * New advanced options including amino acid coloring styles, amino acid grouping, and logo tree leaf ordering '''Version 1.1 beta:''' * New ''Logo Tree'' feature - basic functionality for PDZ or other terminal binding motifs not requiring profile alignment |
Line 15: | Line 38: |
=== Installing and Running === | ---- == Installing and Running == '''Requirements:''' Java Runtime Environment (JRE) 1.5 or later is required to run LOLA. All other dependencies are included in the download. |
Line 22: | Line 47: |
* You can open a single peptide file, or a project file linked to multiple peptide files. | LOLA accepts one or more [wiki:Self:../BRAIN/PeptideFile peptide file] as shown in the example below. A peptide file describes a protein containing a specific domain, and provides known peptide ligands of this domain obtained by an experimental technique. You can open a single peptide file, or multiple peptide files grouped into a [wiki:Self:../BRAIN/PeptideFile#ProjectFiles project file]. |
Line 24: | Line 49: |
Here's a view of LOLA after opening a PDZ domain project file: | Here's a view of LOLA after opening a PDZ domain project file, and after generating a logo tree: |
Line 26: | Line 51: |
attachment:lolaScreenShot.png | attachment:lolaScreenShot-Small.png attachment:lolaScreenShotLogoTree.png |
Line 28: | Line 54: |
=== Input Format === LOLA accepts the BRAIN peptide file format. A peptide file describes a protein containing a specific domain, and provides known peptide ligands of this domain obtained by an experimental technique. Here's a sample: {{{ Gene Name WWP2 Accession Refseq:NP_008945 Entrez:11060 Organism Homo Sapiens (Human) NCBITaxonomyID 9606 Domain Number 4 Domain Type WW Interpro ID IPR001202 Technique Peptide Chip Domain Sequence PALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPG Domain Range 444-478 Comment PeptideName Peptide CloneFrequency QuantData ExternalIdentifier 1 NRLDLPPYETFEDX 1 2 RWDRPPPYVAPPSX 1 3 XXGYTGPPRPPPYG 1 4 XXPHPQPPPYGHCV 1 5 XXNFPAPPPYPGES 1 6 MTPYRSPPPYVPPX 1 7 PGTAPPPYTVGPGY 1 8 YVQPAPPPYPGPMG 1 9 YVQAPPPPYPGPMG 1 10 YVQPPAPPYPGPMG 1 11 TCICPPDYMQVNXX 1 12 HSPPLPPYTPPTLX 1 13 SRGLPPPYDLTWVN 1 14 CGTYPPSYNLTFXX 1 15 DDCQPPAYTYNNXX 1 16 SDLQPPNYYEVMXX 1 17 GLMRPPAYCDAKXX 1 18 YTDAPPAYSELYXX 1 19 STFKPPAYEDVVXX 1 20 SRGMPSYEEAVMAX 1 21 ATSFPPSYESVTXX 1 22 APSAPPSYEETVXX 1 23 NCDPPPTYEEATXX 1 24 LPEPPPPYEFSCXX 1 25 EPENPPPYEEAMXX 1 }}} |
=== Changing memory allocations on Windows, Mac, and Linux machines === |
Line 70: | Line 56: |
==== Header Section ==== | There are a number of ways to change LOLA's memory allocation, depending on your preferred method of opening the application. |
Line 72: | Line 58: |
'''Gene Name:''' An identifier that represents the gene or protein sequence. Not required to be unique. | ==== Option A: Command line startup (note: this does not permanently change LOLA's default 512M setting) ==== |
Line 74: | Line 60: |
'''Accession:''' A space-separated list of database accession identifier for the protein or corresponding gene. | If you are opening LOLA from the command-line using the command: |
Line 76: | Line 62: |
'''Organism:''' Description of taxon of the protein. | * java –Xmx512M –jar lola-VERSION.jar |
Line 78: | Line 64: |
'''NCBITaxonomyID:''' Taxon identifier from NCBI's Taxonomy repository. | then you can increase the value of –Xmx to the desired amount of memory. For example: |
Line 80: | Line 66: |
'''Domain Number:''' A number that represents the position of the domain sequence within the protein. For proteins containing multiple instances of the domain, this number helps distinguish the position of these instances. | * java –Xmx800M –jar lola-VERSION.jar |
Line 82: | Line 68: |
'''Domain Type:''' The formal name of the domain, e.g. WW, PDZ, SH3. | ==== Option B: Using lola.bat (Windows systems) ==== |
Line 84: | Line 70: |
'''InterproID:''' The Interpro database identifier for the domain. | 1. Open the file lola.bat in a text editor (eg. right-click and select Open With Notepad). 2. Increase the value of the –Xmx tag (found in the last line of the file), as per Option A. Do not modify other parts of the file. 3. Save and close the file. 4. Open LOLA by double-clicking on lola.bat. |
Line 86: | Line 75: |
'''Technique:''' The experimental method used to identify potential ligands of the protein. | ==== Option C: Using lola.sh (UNIX, Linux, and Mac OS X systems) ==== |
Line 88: | Line 77: |
'''Domain Sequence:''' The amino-acid sequence of the domain region. | 1. Open the file lola.sh in a text editor (eg. right-click and select Open With TextEdit). 2. Increase the value of the –Xmx tag (found in the last line of the file), as per Option A. Do not modify other parts of the file. 3. Save and close the file. 4. Open LOLA by running lola.sh from the command-line. |
Line 90: | Line 82: |
'''Domain Range:''' The amino-acid position range for the domain region within the protein. | ---- == Future Developments == |
Line 92: | Line 85: |
'''Comment:''' Notes, additional information, personal comments pertaining to this file. ==== Peptide Section ==== '''PeptideName:''' A ''unique'' incremental number assigned to each peptide ligand. '''Peptide:''' The peptide ligand sequence. '''CloneFrequency:''' Applies only to phage display data: the observed frequency of the peptide in the cloning step. '''QuantData:''' A number that relatively or absolutely quantifies the protein-ligand interaction. E.g. The optical density (OD) from a protein chip experiment. '''ExternalIdentifier:''' A database identifier for the peptide. E.g. from the DOMINO repository. === Future Developments === * Generate a "logo tree" by hiearchically clustering logos |
* Enable logo and logo tree parameters to be saved in a project file for later use * Support customized amino acid grouping schemes |
Line 114: | Line 91: |
=== Contact === | ---- == Contact == |
LOLA (LOgos Look Amazing) is a tool for generating sequence logos using Position Weight Matrix based protein profiles. LOLA allows you to generate custom sequence logos by setting parameters such as logo height, trim percentage, and residue colour scheme. You can then save logos in various formats including PDF, PNG, and JPEG.
LOLA is currently in beta-testing. Version 1.2-beta is now available for download.
Downloads
Latest Release
LOLA Version 1.3 Beta (September 29, 2008)BR Build: attachment:LOLA-1.3-beta.tgz BR Source: To be posted by October 2, 2008
Earlier Releases
LOLA Version 1.2 Beta (May 12, 2008)BR Build: attachment:LOLA-1.2-beta.tgz BR Source: attachment:LOLA-1.2-beta-src.tgz
LOLA Version 1.1 Beta (August 22, 2007)BR Build: attachment:LOLA-1.1-beta.tgz BR Source: attachment:LOLA-1.1-beta-src.tgz
Release Notes
Version 1.3 beta:
- Progress bars now appear for long-running tasks such as loading peptide file and generating logos and logo trees
- Notable bug fixes:
- Selected profiles now correctly closed with the "Close Selected" button.
- Regenerating a logo tree after closing some profiles now correctly excludes the closed profiles.
Version 1.2 beta:
- Logo trees can be generated for all types of domains - not only terminal binding
- New advanced options including amino acid coloring styles, amino acid grouping, and logo tree leaf ordering
Version 1.1 beta:
New Logo Tree feature - basic functionality for PDZ or other terminal binding motifs not requiring profile alignment
Installing and Running
Requirements: Java Runtime Environment (JRE) 1.5 or later is required to run LOLA. All other dependencies are included in the download.
- Extract the TAR file. This will create a directory named "lola".
- On Linux, open the command shell and run "lola.sh" from the "lola" directory.
- On Windows, double click "lola.bat".
- On Mac, double click lola-1.0-beta.jar
LOLA accepts one or more [wiki:Self:../BRAIN/PeptideFile peptide file] as shown in the example below. A peptide file describes a protein containing a specific domain, and provides known peptide ligands of this domain obtained by an experimental technique. You can open a single peptide file, or multiple peptide files grouped into a [wiki:Self:../BRAIN/PeptideFile#ProjectFiles project file].
Here's a view of LOLA after opening a PDZ domain project file, and after generating a logo tree:
attachment:lolaScreenShot-Small.png attachment:lolaScreenShotLogoTree.png
Changing memory allocations on Windows, Mac, and Linux machines
There are a number of ways to change LOLA's memory allocation, depending on your preferred method of opening the application.
Option A: Command line startup (note: this does not permanently change LOLA's default 512M setting)
If you are opening LOLA from the command-line using the command:
- java –Xmx512M –jar lola-VERSION.jar
then you can increase the value of –Xmx to the desired amount of memory. For example:
- java –Xmx800M –jar lola-VERSION.jar
Option B: Using lola.bat (Windows systems)
- Open the file lola.bat in a text editor (eg. right-click and select Open With Notepad).
- Increase the value of the –Xmx tag (found in the last line of the file), as per Option A. Do not modify other parts of the file.
- Save and close the file.
- Open LOLA by double-clicking on lola.bat.
Option C: Using lola.sh (UNIX, Linux, and Mac OS X systems)
Open the file lola.sh in a text editor (eg. right-click and select Open With TextEdit).
- Increase the value of the –Xmx tag (found in the last line of the file), as per Option A. Do not modify other parts of the file.
- Save and close the file.
- Open LOLA by running lola.sh from the command-line.
Future Developments
- Enable logo and logo tree parameters to be saved in a project file for later use
- Support customized amino acid grouping schemes
- Allow colours to be selected for individual amino-acids
- Add support for nucleic acids
- Additional visualization options (e.g. font, axis labels)
Contact
If you have any questions or feedback, please email Moyez Dharsee at mdharsee@infochromics.com.